PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI03G32880.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 321aa    MW: 35335.3 Da    PI: 7.7756
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI03G32880.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.64.5e-161462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd +l+ +++q G+g +W + ++++g++R++k+c++rw++yl
  OMERI03G32880.1 14 KGPWSPEEDAKLKSYIEQNGTGgNWIALPQKIGLKRCGKSCRLRWLNYL 62
                     79*********************************************97 PP

2Myb_DNA-binding38.72.3e-1269111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +++eEd +++ +    G++ W+ Ia+ ++ gRt++++k++w++
  OMERI03G32880.1  69 GGFSEEEDRIILSLYISIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
                      569******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.706962IPR017930Myb domain
SuperFamilySSF466892.04E-2611109IPR009057Homeodomain-like
SMARTSM007176.5E-121364IPR001005SANT/Myb domain
PfamPF002495.0E-151462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.6E-241569IPR009057Homeodomain-like
CDDcd001677.39E-91662No hitNo description
PROSITE profilePS5129422.33263117IPR017930Myb domain
SMARTSM007175.6E-1267115IPR001005SANT/Myb domain
PfamPF002494.1E-1169111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-2370117IPR009057Homeodomain-like
CDDcd001674.65E-971113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
MGRAPCCDKA SVKKGPWSPE EDAKLKSYIE QNGTGGNWIA LPQKIGLKRC GKSCRLRWLN  60
YLRPNIKHGG FSEEEDRIIL SLYISIGSRW SIIAAQLPGR TDNDIKNYWN TRLKKKLFGK  120
QSRKDQRQQQ HLARQAAAAA SDLQIKQEAS RGANEADGLA AGANYTWHHH HAMAVPVHPM  180
SAPMVVEGGR VGDDVDESIR KLLFKLGGNP FAASPAPPCI PPPPMYEEAP SFVPPLAHGV  240
PLNEGGMQCS SVLPALELDE SFHFNHVKLD GLECLFGMGD HQNMRWNEVS PLVCPNHAVA  300
SSSQGMQQYC LVEEPADLGM Q
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-25141177108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1120180.0AK112018.1 Oryza sativa Japonica Group cDNA clone:006-308-C02, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015628327.10.0PREDICTED: transcription factor RAX3
TrEMBLA0A0E0D7H50.0A0A0E0D7H5_9ORYZ; Uncharacterized protein
STRINGBGIOSGA009746-PA0.0(Oryza sativa Indica Group)
STRINGORGLA03G0327000.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP13538412
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.16e-81myb domain protein 36